PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_23373V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 292aa    MW: 32117.1 Da    PI: 4.0844
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_23373V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC46.67.4e-151552252090
               NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifd 90 
                         ++P++r+k+i+k d+dv+ +s++a +l+++a  lf+  l+  s+    ++kr+t++  d+  a ++t  f 
  Pp3c13_23373V3.1.p 155 AFPITRVKRIIKLDKDVRLVSSDALALITQATALFVQSLSSASFKVMLQSKRKTIRGPDVILAAKSTRQFR 225
                         69*************************************************************99999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.5E-15156217IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.9E-17156224IPR009072Histone-fold
SuperFamilySSF471132.1E-15156225IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTDPGTPDSH GSPDTPGSPE ELHDLIETKD MNLDMTENDL DEEKGYDENG LMTNLSTPDN  60
PGTPRDEFSD DSHELDETKD ANLDIIENDL GESGTDDDAQ DTDPVTPQEG LPRYGDDPDE  120
TKDMNVDGAE KSFEMLDDGQ DEGEKSFDGE RFVPAFPITR VKRIIKLDKD VRLVSSDALA  180
LITQATALFV QSLSSASFKV MLQSKRKTIR GPDVILAAKS TRQFRECLEN DLATLLEESN  240
QDTANGEDIP VEKEHGTSGE PTRKRSQQPK SSKKQQLAPP GSRPITIFFK T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.184740.0protonema
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S37_218V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43250.11e-11nuclear factor Y, subunit C13